Structure of PDB 1qbn Chain A

Receptor sequence

>1qbnA (length=223) Species: 9913 (Bos taurus)

IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRL
GEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRV
ASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKS
AYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQK
NKPGVYTKVCNYVSWIKQTIASN

3D structure

• PDB: 1qbn Crystallographic analysis of potent and selective factor Xa inhibitors complexed to bovine trypsin.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H46 D90 Q180 G181 D182 S183 G184
• Catalytic site (residue number reindexed from 1): H40 D84 Q174 G175 D176 S177 G178
• Enzyme Commision number: 3.4.21.4: trypsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	E58 N60 V63 E68	E52 N54 V57 E62
BS02	CA	A	D59 E65	D53 E59
BS03	688	A	N85 D177 S178 Q180 W199 G200 G202 C203	N79 D171 S172 Q174 W193 G194 G196 C197	MOAD: Ki=1400nM PDBbind-CN: -logKd/Ki=5.85,Ki=1400nM

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004252 serine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0008236 serine-type peptidase activity
• GO:0046872 metal ion binding
• GO:0097655 serpin family protein binding

Biological Process

• GO:0006508 proteolysis
• GO:0007586 digestion

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0097180 serine protease inhibitor complex

External links

• PDB: RCSB:1qbn, PDBe:1qbn, PDBj:1qbn
• PDBsum: 1qbn
• PubMed: 10417407
• UniProt: P00760|TRY1_BOVIN Serine protease 1 (Gene Name=PRSS1)