Structure of PDB 1q9s Chain A

Receptor sequence

>1q9sA (length=149) Species: 9606 (Homo sapiens)

IMRHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYG
WASVGSGDVHKMVVSIGWNPYYKNTKKSMETHIMHTFKEDFYGEILNVAI
VGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEYLKIKEDNFFQVSK

3D structure

• PDB: 1q9s Ligand binding-induced conformational changes in riboflavin kinase: structural basis for the ordered mechanism.
• Chain: A
• Resolution: 2.42 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.26: riboflavin kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	T34 N36	T28 N30
BS02	ADP	A	G22 G24 G26 S27 P33 T34 I89 F93 D96 F97 Y98	G16 G18 G20 S21 P27 T28 I83 F87 D90 F91 Y92
BS03	FMN	A	G22 F23 G24 R25 G26 T34 N36 I53 V69 S71 N75 P76 Y77 Y78 E86 R111 K114 L122 I126 D129	G16 F17 G18 R19 G20 T28 N30 I47 V63 S65 N69 P70 Y71 Y72 E80 R105 K108 L116 I120 D123

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008531 riboflavin kinase activity
• GO:0016301 kinase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006771 riboflavin metabolic process
• GO:0006915 apoptotic process
• GO:0009231 riboflavin biosynthetic process
• GO:0009398 FMN biosynthetic process
• GO:0016310 phosphorylation
• GO:0033864 positive regulation of NAD(P)H oxidase activity
• GO:0072388 flavin adenine dinucleotide biosynthetic process
• GO:0072593 reactive oxygen species metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol

External links

• PDB: RCSB:1q9s, PDBe:1q9s, PDBj:1q9s
• PDBsum: 1q9s
• PubMed: 14580199
• UniProt: Q969G6|RIFK_HUMAN Riboflavin kinase (Gene Name=RFK)