Structure of PDB 1q5y Chain A |
>1q5yA (length=84) Species: 562 (Escherichia coli) [Search protein sequence] |
TQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIA VLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKED |
|
PDB | 1q5y Crystal Structure of the Nickel-Responsive Transcription Factor NikR |
Chain | A |
Resolution | 1.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NI |
A |
H87 H89 C95 |
H38 H40 C46 |
|
|
|