Structure of PDB 1q1q Chain A

Receptor sequence
>1q1qA (length=278) Species: 9606 (Homo sapiens) [Search protein sequence]
LPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWM
IEIICLILKEGDPSWIRSVPIWERAPWCETIVGASPRLMSSHLPIQIFTK
AFFSSKAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGE
VQFGSWFDHIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLG
KEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKN
HFTVAQSEAFDRAYRKQMRGMPTFPWDE
3D structure
PDB1q1q Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms.
ChainA
Resolution2.91 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K55 H110 S140
Catalytic site (residue number reindexed from 1) K44 H92 S122
Enzyme Commision number 2.8.2.2: alcohol sulfotransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 A3P A K55 G57 T58 T59 W60 R132 S140 Y195 F231 L258 R259 G261 K44 G46 T47 T48 W49 R114 S122 Y177 F213 L240 R241 G243
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004027 alcohol sulfotransferase activity
GO:0005515 protein binding
GO:0008146 sulfotransferase activity
GO:0015485 cholesterol binding
GO:0016740 transferase activity
GO:0036094 small molecule binding
GO:0050294 steroid sulfotransferase activity
GO:0051922 cholesterol sulfotransferase activity
GO:1990239 steroid hormone binding
Biological Process
GO:0008202 steroid metabolic process
GO:0008203 cholesterol metabolic process
GO:0008285 negative regulation of cell population proliferation
GO:0045606 positive regulation of epidermal cell differentiation
GO:0050427 3'-phosphoadenosine 5'-phosphosulfate metabolic process
GO:0051923 sulfation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1q1q, PDBe:1q1q, PDBj:1q1q
PDBsum1q1q
PubMed12923182
UniProtO00204|ST2B1_HUMAN Sulfotransferase 2B1 (Gene Name=SULT2B1)

[Back to BioLiP]