Structure of PDB 1pzw Chain A |
>1pzwA (length=80) Species: 7227 (Drosophila melanogaster) [Search protein sequence] |
DICRLCLRGVSGAQMCLQIFDVDSGESKVAEVLRQHFWFEVLPNDEISKV ICNVCWTQVSEFHQFYVSIQEAQVIYATTS |
|
PDB | 1pzw The zinc finger-associated domain of the Drosophila transcription factor grauzone is a novel zinc-coordinating protein-protein interaction module |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C4 C7 C56 |
C3 C6 C55 |
|
|
|
|