Structure of PDB 1pzb Chain A |
>1pzbA (length=120) Species: 511 (Alcaligenes faecalis) [Search protein sequence] |
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIP EGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLD QIVSAKKPKIVQERLEKVIA |
|
PDB | 1pzb The crystal structures of reduced pseudoazurin from Alcaligenes faecalis S-6 at two pH values. |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H40 C78 M86 |
H40 C78 M86 |
|
|
|
|