Structure of PDB 1pyi Chain A

Receptor sequence
>1pyiA (length=88) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYVFF
LEDRLAVMMRVLKEYGVDPTKIRGNIPATSDDEPFDLK
3D structure
PDB1pyi Crystal structure of a PPR1-DNA complex: DNA recognition by proteins containing a Zn2Cys6 binuclear cluster.
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K40 K41 K11 K12
BS02 dna A S30 R31 R38 K41 K43 S1 R2 R9 K12 K14
BS03 ZN A C34 C54 C61 C5 C25 C32
BS04 ZN A C34 C37 C44 C51 C5 C8 C15 C22
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1pyi, PDBe:1pyi, PDBj:1pyi
PDBsum1pyi
PubMed7958913
UniProtP07272|PPR1_YEAST Pyrimidine pathway regulatory protein 1 (Gene Name=PPR1)

[Back to BioLiP]