Structure of PDB 1pua Chain A

Receptor sequence

>1puaA (length=162) Species: 5911 (Tetrahymena thermophila)

LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMV
ILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDH
MQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLM
ECYIHPYVDYGR

3D structure

• PDB: 1pua Structural basis for histone and phospho-histone binding by the GCN5 histone acetyltransferase
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y115 F120 E122 V123 A124 L126 L158 I189 Y192
• Catalytic site (residue number reindexed from 1): Y67 F72 E74 V75 A76 L78 L110 I141 Y144
• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	P78 K79 M80 Y84 K87 L88 H94 R113 Y115 E122 V123 A124 F125 L126 T159 Y160 D162 N163 F164 A165 F169 Y188 I189 K190 D191	P30 K31 M32 Y36 K39 L40 H46 R65 Y67 E74 V75 A76 F77 L78 T111 Y112 D114 N115 F116 A117 F121 Y140 I141 K142 D143
BS02	COA	A	Q76 L77 L126 A127 V128 Q133 V134 G136 G138 T139 F164	Q28 L29 L78 A79 V80 Q85 V86 G88 G90 T91 F116

Gene Ontology

Molecular Function

• GO:0004402 histone acetyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

External links

• PDB: RCSB:1pua, PDBe:1pua, PDBj:1pua
• PDBsum: 1pua
• PubMed: 14536085
• UniProt: Q27198