Structure of PDB 1poh Chain A

Receptor sequence
>1pohA (length=85) Species: 562 (Escherichia coli) [Search protein sequence]
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKL
QTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE
3D structure
PDB1poh The 2.0-A resolution structure of Escherichia coli histidine-containing phosphocarrier protein HPr. A redetermination.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SO4 A N38 K40 N38 K40
Gene Ontology
Molecular Function
GO:0004857 enzyme inhibitor activity
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor
GO:0030234 enzyme regulator activity
GO:0045152 antisigma factor binding
Biological Process
GO:0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0043609 regulation of carbon utilization
GO:0045819 positive regulation of glycogen catabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1poh, PDBe:1poh, PDBj:1poh
PDBsum1poh
PubMed8226757
UniProtP0AA04|PTHP_ECOLI Phosphocarrier protein HPr (Gene Name=ptsH)

[Back to BioLiP]