Structure of PDB 1phk Chain A

Receptor sequence

>1phkA (length=277) Species: 9986 (Oryctolagus cuniculus)

FYENYEPKEILGRGVSSVVRRCIHKPTCKEYAVKIIDVTGGGSFSAEEVQ
ELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKKGELFDY
LTEKVTLSEKETRKIMRALLEVICALHKLNIVHRDLKPENILLDDDMNIK
LTDFGFSCQLDPGEKLREVCGTPSYLAPEIIECSMNDNHPGYGKEVDMWS
TGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLV
SRFLVVQPQKRYTAEEALAHPFFQQYV

3D structure

• PDB: 1phk Two structures of the catalytic domain of phosphorylase kinase: an active protein kinase complexed with substrate analogue and product.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D149 K151 N154 D167 T186
• Catalytic site (residue number reindexed from 1): D135 K137 N140 D153 T172
• Enzyme Commision number: 2.7.11.1: non-specific serine/threonine protein kinase.
  2.7.11.19: phosphorylase kinase.
  2.7.11.26: [tau protein] kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	N154 D167	N140 D153
BS02	ATP	A	L25 G26 G28 V33 A46 K48 M106 E110 L156 D167	L11 G12 G14 V19 A32 K34 M92 E96 L142 D153

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004689 phosphorylase kinase activity
• GO:0005516 calmodulin binding
• GO:0005524 ATP binding

Biological Process

• GO:0005977 glycogen metabolic process
• GO:0006468 protein phosphorylation

Cellular Component

• GO:0005964 phosphorylase kinase complex

External links

• PDB: RCSB:1phk, PDBe:1phk, PDBj:1phk
• PDBsum: 1phk
• PubMed: 7663944
• UniProt: P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (Gene Name=PHKG1)