Structure of PDB 1paz Chain A |
>1pazA (length=120) Species: 511 (Alcaligenes faecalis) [Search protein sequence] |
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIP EGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLD QIVSAKKPKIVQERLEKVIA |
|
PDB | 1paz Refinement of the structure of pseudoazurin from Alcaligenes faecalis S-6 at 1.55 A resolution. |
Chain | A |
Resolution | 1.55 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H40 C78 H81 M86 |
H40 C78 H81 M86 |
|
|
|
|