Structure of PDB 1pau Chain A |
>1pauA (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGP VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE |
|
PDB | 1pau The three-dimensional structure of apopain/CPP32, a key mediator of apoptosis. |
Chain | A |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
R179 C285 |
R31 C130 |
|
|
|
|