Structure of PDB 1p6o Chain A

Receptor sequence
>1p6oA (length=156) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNM
RFQKGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYG
IPRCVVGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDERPQDW
FEDIGE
3D structure
PDB1p6o The 1.14 a crystal structure of yeast Cytosine deaminase. Evolution of nucleotide salvage enzymes and implications for genetic chemotherapy.
ChainA
Resolution1.14 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H62 C91 C94
Catalytic site (residue number reindexed from 1) H60 C89 C92
Enzyme Commision number 3.5.4.1: cytosine deaminase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H62 C91 C94 H60 C89 C92
BS02 HPY A I33 N51 H62 E64 C91 C94 D155 I31 N49 H60 E62 C89 C92 D153
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004131 cytosine deaminase activity
GO:0008270 zinc ion binding
GO:0008835 diaminohydroxyphosphoribosylaminopyrimidine deaminase activity
GO:0016787 hydrolase activity
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
GO:0019239 deaminase activity
GO:0046872 metal ion binding
Biological Process
GO:0008655 pyrimidine-containing compound salvage
GO:0019858 cytosine metabolic process
GO:0034654 nucleobase-containing compound biosynthetic process
GO:0044206 UMP salvage
GO:0046087 cytidine metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1p6o, PDBe:1p6o, PDBj:1p6o
PDBsum1p6o
PubMed12906827
UniProtQ12178|FCY1_YEAST Cytosine deaminase (Gene Name=FCY1)

[Back to BioLiP]