Structure of PDB 1p6d Chain A

Receptor sequence

>1p6dA (length=245) Species: 1396 (Bacillus cereus)

WSAEDKHKEGVNSHLWIVNRAIDIMSRNTTLVKQDRVAQLNEWRTELENG
IYAANYENPYYDNSTFASHFYDPDNGKTYIPFAKQAKETGAKYFKLAGES
YKNKDMKQAFFYLGLSLHYLGDVNQPMHAANFTNLSYPQGFHSKYENFVD
TIKDNYKVTDGNGYWNWKGTNPEEWIHGAAVVAKQDYSGIVNDNTKDWFV
KAAVSQEYADKWRAEVTPMTGKRLMDAQRVTAGYIQLWFDTYGDR

3D structure

• PDB: 1p6d Using X-ray crystallography of the Asp55Asn mutant of the phosphatidylcholine-preferring phospholipase C from Bacillus cereus to support the mechanistic role of Asp55 as the general base.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H14 N55 H69 H118 D122 H128 H142 E146
• Catalytic site (residue number reindexed from 1): H14 N55 H69 H118 D122 H128 H142 E146
• Enzyme Commision number: 3.1.4.3: phospholipase C.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H69 H118 D122	H69 H118 D122
BS02	ZN	A	H128 H142 E146	H128 H142 E146
BS03	ZN	A	W1 H14 D122	W1 H14 D122
BS04	3PC	A	W1 E4 N55 F66 H118 D122 H128 T133 N134 E146	W1 E4 N55 F66 H118 D122 H128 T133 N134 E146	MOAD: Ki=1.15mM PDBbind-CN: -logKd/Ki=2.94,Ki=1.15mM

Gene Ontology

Molecular Function

• GO:0004629 phospholipase C activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016788 hydrolase activity, acting on ester bonds
• GO:0034480 phosphatidylcholine phospholipase C activity
• GO:0046872 metal ion binding

Biological Process

• GO:0031640 killing of cells of another organism

External links

• PDB: RCSB:1p6d, PDBe:1p6d, PDBj:1p6d
• PDBsum: 1p6d
• PubMed: 12921783
• UniProt: P09598|PHLC_BACCE Phospholipase C (Gene Name=plc)