Structure of PDB 1p3l Chain A

Receptor sequence
>1p3lA (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVHIMPKDIQLARRIRGERA
3D structure
PDB1p3l Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R440 R442 T445 R463 R472 R483 F484 Q485 R516 V517 H518 R3 R5 T8 R26 R35 R46 F47 Q48 R79 V80 H81
BS02 dna A R440 Y441 V446 R449 R463 L465 P466 R469 R483 R3 Y4 V9 R12 R26 L28 P29 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1p3l, PDBe:1p3l, PDBj:1p3l
PDBsum1p3l
PubMed14739929
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]