Structure of PDB 1p3b Chain A

Receptor sequence
>1p3bA (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB1p3b Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
ChainA
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R440 R442 P443 T445 R463 R472 R483 F484 Q485 R516 V517 T518 R4 R6 P7 T9 R27 R36 R47 F48 Q49 R80 V81 T82
BS02 dna A K437 H439 R440 Y441 G444 V446 R449 R463 K464 L465 P466 R469 R483 K1 H3 R4 Y5 G8 V10 R13 R27 K28 L29 P30 R33 R47
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1p3b, PDBe:1p3b, PDBj:1p3b
PDBsum1p3b
PubMed14739929
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]