Structure of PDB 1p34 Chain A

Receptor sequence
>1p34A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKAVTIMPKDIQLARRIRGERA
3D structure
PDB1p34 Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
ChainA
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R440 Y441 R442 T445 R463 R472 R483 F484 Q485 S486 A516 V517 T518 M520 K522 R3 Y4 R5 T8 R26 R35 R46 F47 Q48 S49 A79 V80 T81 M83 K85
BS02 dna A R440 Y441 P443 G444 V446 R449 R463 L465 R483 R3 Y4 P6 G7 V9 R12 R26 L28 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1p34, PDBe:1p34, PDBj:1p34
PDBsum1p34
PubMed14739929
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]