Structure of PDB 1p19 Chain A

Receptor sequence

>1p19A (length=187) Species: 5693 (Trypanosoma cruzi)

PREYEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVL
KGSFMFTADLCRALCDFNVPVRMEFICVSSYGLTSSGQVRMLLDTRHSIE
GHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSA
DYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVY

3D structure

• PDB: 1p19 Interactions at the dimer interface influence the relative efficiencies for purine nucleotide synthesis and pyrophosphorolysis in a phosphoribosyltransferase.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E111 D112 D115 F164 R177
• Catalytic site (residue number reindexed from 1): E108 D109 D112 F161 R174
• Enzyme Commision number: 2.4.2.8: hypoxanthine phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IMP	A	D112 I113 D115 T116 A117 K143 F164 V165	D109 I110 D112 T113 A114 K140 F161 V162	MOAD: Kd=76.8uM PDBbind-CN: -logKd/Ki=4.11,Kd=76.8uM

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0046872 metal ion binding
• GO:0052657 guanine phosphoribosyltransferase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006178 guanine salvage
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0046100 hypoxanthine metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1p19, PDBe:1p19, PDBj:1p19
• PDBsum: 1p19
• PubMed: 14698288
• UniProt: Q4DRC4