Structure of PDB 1ozp Chain A

Receptor sequence

>1ozpA (length=290) Species: 83332 (Mycobacterium tuberculosis H37Rv)

ALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLRELGQQRTEHLLV
AGSRPGGPIIGYLNLSPPGGAMAELVVHPQSRRRGIGTAMARAALAKTAG
RNQFWAHGTLDPARATASALGLVGVRELIQMRRPLRDIPEPTIPDGVVIR
TYAGTSDDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDGLILA
FGDGRLLGFHWTKVHPDHPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSL
ARRLVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYAL

3D structure

• PDB: 1ozp Crystal structure of mycothiol synthase (Rv0819) from Mycobacterium tuberculosis shows structural homology to the GNAT family of N-acetyltransferases.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.189: mycothiol synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ACO	A	L80 V81 V82 R87 R88 G90 G92 T93 W110 P117 A118 A120 T121 A124	L75 V76 V77 R82 R83 G85 G87 T88 W105 P112 A113 A115 T116 A119
BS02	ACO	A	A173 F174 L238 V240 Q245 R246 G248 G250 Q251 Y282 A289 A290 R292 T293 Y294	A168 F169 L227 V229 Q234 R235 G237 G239 Q240 Y262 A269 A270 R272 T273 Y274

Gene Ontology

Molecular Function

• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0035447 mycothiol synthase activity

Biological Process

• GO:0010125 mycothiol biosynthetic process
• GO:0010126 mycothiol metabolic process
• GO:0051701 biological process involved in interaction with host
• GO:0070301 cellular response to hydrogen peroxide
• GO:0071468 cellular response to acidic pH

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1ozp, PDBe:1ozp, PDBj:1ozp
• PDBsum: 1ozp
• PubMed: 12930994
• UniProt: P9WJM7|MSHD_MYCTU Mycothiol acetyltransferase (Gene Name=mshD)