Structure of PDB 1oth Chain A

Receptor sequence
>1othA (length=321) Species: 9606 (Homo sapiens) [Search protein sequence]
KVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLG
MIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSS
MADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHY
SSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLA
EQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGREEEKKKRLQAFQG
YQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWT
IMAVMVSLLTDYSPQLQKPKF
3D structure
PDB1oth 1.85-A resolution crystal structure of human ornithine transcarbamoylase complexed with N-phosphonacetyl-L-ornithine. Catalytic mechanism and correlation with inherited deficiency.
ChainA
Resolution1.85 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R92 T93 V120 R141 H168 Q171 D263 C303 R330
Catalytic site (residue number reindexed from 1) R59 T60 V87 R108 H135 Q138 D230 C270 R297
Enzyme Commision number 2.1.3.3: ornithine carbamoyltransferase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 PAO A S90 T91 R92 T93 R141 L163 H168 N199 D263 S267 M268 C303 L304 R330 S57 T58 R59 T60 R108 L130 H135 N166 D230 S234 M235 C270 L271 R297 PDBbind-CN: -logKd/Ki=7.00,Ki=0.1uM
BindingDB: Ki=100nM
Gene Ontology
Molecular Function
GO:0004585 ornithine carbamoyltransferase activity
GO:0005543 phospholipid binding
GO:0016597 amino acid binding
GO:0016740 transferase activity
GO:0016743 carboxyl- or carbamoyltransferase activity
GO:0042301 phosphate ion binding
GO:0042802 identical protein binding
Biological Process
GO:0000050 urea cycle
GO:0001889 liver development
GO:0006520 amino acid metabolic process
GO:0006526 L-arginine biosynthetic process
GO:0006591 ornithine metabolic process
GO:0006593 ornithine catabolic process
GO:0007494 midgut development
GO:0009410 response to xenobiotic stimulus
GO:0010043 response to zinc ion
GO:0019240 citrulline biosynthetic process
GO:0031667 response to nutrient levels
GO:0032868 response to insulin
GO:0042450 arginine biosynthetic process via ornithine
GO:0055081 monoatomic anion homeostasis
GO:0070781 response to biotin
GO:0097272 ammonium homeostasis
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1oth, PDBe:1oth, PDBj:1oth
PDBsum1oth
PubMed9852088
UniProtP00480|OTC_HUMAN Ornithine transcarbamylase, mitochondrial (Gene Name=OTC)

[Back to BioLiP]