Structure of PDB 1os6 Chain A

Receptor sequence

>1os6A (length=71) Species: 35554 (Geobacter sulfurreducens) [Search protein sequence]

ADDIVLKAKNGDVKFPHKAHQKAVPDCKKCHEKGPGKIEGFGKEMAHGKG
CKGCHEEMKKGPTKCGECHKK

3D structure

PDB

1os6 Family of cytochrome c7-type proteins from Geobacter sulfurreducens: structure of one cytochrome c7 at 1.45 A resolution.

Chain

Resolution

1.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	A	A1 D2 D3 I4 F15 H17 Q21 V24 C27 C30 H31	A1 D2 D3 I4 F15 H17 Q21 V24 C27 C30 H31
BS02	HEC	A	H20 A23 G50 C51 C54 H55 M58 K60 G61 P62	H20 A23 G50 C51 C54 H55 M58 K60 G61 P62
BS03	HEC	A	L6 A8 K9 N10 G42 A46 H47 C51 K52 H55 T63 K64 C65 C68 H69	L6 A8 K9 N10 G42 A46 H47 C51 K52 H55 T63 K64 C65 C68 H69
BS04	DXC	A	I4 K37 I38 F41 G50	I4 K37 I38 F41 G50

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding

External links