Structure of PDB 1oro Chain A

Receptor sequence

>1oroA (length=213) Species: 562 (Escherichia coli)

MKPYQRQFIEFALSKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRDLALLG
RFYAEALVDSGIEFDLLFGPAYKGIPIATTTAVALAEHHDLDLPYCFNRK
EAKDHGEGGNLVGSALQGRVMLVDDVITAGTAIRESMEIIQANGATLAGV
LISLDRQERGRGEISAIQEVERDYNCKVISIITLKDLIAYLEEKPEMAEH
LAAVKAYREEFGV

3D structure

• PDB: 1oro A flexible loop at the dimer interface is a part of the active site of the adjacent monomer of Escherichia coli orotate phosphoribosyltransferase.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K103 H105
• Catalytic site (residue number reindexed from 1): K103 H105
• Enzyme Commision number: 2.4.2.10: orotate phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	A	A71 Y72 K73 K100	A71 Y72 K73 K100

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004588 orotate phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0044205 'de novo' UMP biosynthetic process
• GO:0046132 pyrimidine ribonucleoside biosynthetic process
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0072528 pyrimidine-containing compound biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1oro, PDBe:1oro, PDBj:1oro
• PDBsum: 1oro
• PubMed: 8620002
• UniProt: P0A7E3|PYRE_ECOLI Orotate phosphoribosyltransferase (Gene Name=pyrE)