Structure of PDB 1or8 Chain A

Receptor sequence
>1or8A (length=313) Species: 10116 (Rattus norvegicus) [Search protein sequence]
HFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAK
AGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDI
IISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQY
KDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIY
TVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESP
YTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQ
LCELSCSTDYRMR
3D structure
PDB1or8 Structure of the Predominant Protein Arginine Methyltransferase PRMT1 and Analysis of Its Binding to Substrate Peptides
ChainA
Resolution2.35 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D51 E144 E153 H293
Catalytic site (residue number reindexed from 1) D11 E104 E113 H253
Enzyme Commision number 2.1.1.319: type I protein arginine methyltransferase.
Interaction with ligand
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008170 N-methyltransferase activity
GO:0008276 protein methyltransferase activity
GO:0008327 methyl-CpG binding
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
GO:0016274 protein-arginine N-methyltransferase activity
GO:0019899 enzyme binding
GO:0030519 snoRNP binding
GO:0035241 protein-arginine omega-N monomethyltransferase activity
GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0042802 identical protein binding
GO:0044020 histone H4R3 methyltransferase activity
GO:0048273 mitogen-activated protein kinase p38 binding
GO:0106080 GATOR1 complex binding
GO:1904047 S-adenosyl-L-methionine binding
Biological Process
GO:0001701 in utero embryonic development
GO:0006338 chromatin remodeling
GO:0006479 protein methylation
GO:0006974 DNA damage response
GO:0008284 positive regulation of cell population proliferation
GO:0008380 RNA splicing
GO:0018216 peptidyl-arginine methylation
GO:0019919 peptidyl-arginine methylation, to asymmetrical-dimethyl arginine
GO:0030510 regulation of BMP signaling pathway
GO:0031175 neuron projection development
GO:0032259 methylation
GO:0035247 peptidyl-arginine omega-N-methylation
GO:0045648 positive regulation of erythrocyte differentiation
GO:0045652 regulation of megakaryocyte differentiation
GO:0045653 negative regulation of megakaryocyte differentiation
GO:0045727 positive regulation of translation
GO:0046329 negative regulation of JNK cascade
GO:0046500 S-adenosylmethionine metabolic process
GO:0046985 positive regulation of hemoglobin biosynthetic process
GO:0048738 cardiac muscle tissue development
GO:0051260 protein homooligomerization
GO:0061431 cellular response to methionine
GO:0097421 liver regeneration
GO:1900745 positive regulation of p38MAPK cascade
GO:1904263 positive regulation of TORC1 signaling
GO:1905168 positive regulation of double-strand break repair via homologous recombination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0034709 methylosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1or8, PDBe:1or8, PDBj:1or8
PDBsum1or8
PubMed12737817
UniProtQ63009|ANM1_RAT Protein arginine N-methyltransferase 1 (Gene Name=Prmt1)

[Back to BioLiP]