Structure of PDB 1oq6 Chain A |
>1oq6A (length=76) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIY DPAETGTAAIQEKIEKLGYHVVIEGR |
|
PDB | 1oq6 A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
7.2.2.8: P-type Cu(+) transporter. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
C17 C20 |
C17 C20 |
|
|
|
|