Structure of PDB 1opr Chain A

Receptor sequence

>1oprA (length=213)

MKPYQRQFIEFALNKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRDLALLG
RFYAEALVDSGIEFDLLFGPAYKGIPIATTTAVALAEHHDKDLPYCFNRK
EAKDHGEGGSLVGSALQGRVMLVDDVITAGTAIRESMEIIQAHGATLAGV
LISLDRQERGRGEISAIQEVERDYGCKVISIITLKDLIAYLEEKPDMAEH
LAAVRAYREEFGV

3D structure

• PDB: 1opr The crystal structure of the orotate phosphoribosyltransferase complexed with orotate and alpha-D-5-phosphoribosyl-1-pyrophosphate.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K103 H105
• Catalytic site (residue number reindexed from 1): K103 H105
• Enzyme Commision number: 2.4.2.10: orotate phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ORO	A	L25 K26 F34 F35 R156	L25 K26 F34 F35 R156
BS02	PRP	A	Y72 K73 K100 D124 D125 I127 T128 A129 G130 T131 A132	Y72 K73 K100 D124 D125 I127 T128 A129 G130 T131 A132

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004588 orotate phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0044205 'de novo' UMP biosynthetic process
• GO:0046132 pyrimidine ribonucleoside biosynthetic process
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0072528 pyrimidine-containing compound biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1opr, PDBe:1opr, PDBj:1opr
• PDBsum: 1opr
• PubMed: 7545004
• UniProt: P08870|PYRE_SALTY Orotate phosphoribosyltransferase (Gene Name=pyrE)