Structure of PDB 1ooh Chain A

Receptor sequence

>1oohA (length=126) Species: 7227 (Drosophila melanogaster)

SHMTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYT
KCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQ
FKESCERVYQTAKCFSENADGQFMWP

3D structure

• PDB: 1ooh Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster
• Chain: A
• Resolution: 1.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1BO	A	S52 A55 T57 F113	S54 A57 T59 F115

Gene Ontology

Molecular Function

• GO:0005549 odorant binding
• GO:0005550 pheromone binding
• GO:0035274 diphenyl phthalate binding
• GO:0035275 dibutyl phthalate binding
• GO:0035276 ethanol binding

Biological Process

• GO:0007608 sensory perception of smell
• GO:0007619 courtship behavior
• GO:0019236 response to pheromone
• GO:0042048 olfactory behavior
• GO:0045471 response to ethanol

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1ooh, PDBe:1ooh, PDBj:1ooh
• PDBsum: 1ooh
• PubMed: 12881720
• UniProt: O02372|OB76A_DROME General odorant-binding protein lush (Gene Name=lush)