Structure of PDB 1one Chain A

Receptor sequence

>1oneA (length=436) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AVSKVYARSVYDSRGNPTVEVELTTEKGVFRSIVPSGASTGVHEALEMRD
GDKSKWMGKGVLHAVKNVNDVIAPAFVKANIDVKDQKAVDDFLISLDGTA
NKSKLGANAILGVSLAASRAAAAEKNVPLYKHLADLSKSKTSPYVLPVPF
LNVLNGGSHAGGALALQEFMIAPTGAKTFAEALRIGSEVYHNLKSLTKKR
YGASAGNVGDEGGVAPNIQTAEEALDLIVDAIKAAGHDGKVKIGLDCASS
EFFKDGKYDLDFKNPNSDKSKWLTGPQLADLYHSLMKRYPIVSIEDPFAE
DDWEAWSHFFKTAGIQIVADDLTVTNPKRIATAIEKKAADALLLKVNQIG
TLSESIKAAQDSFAAGWGVMVSHRSGETEDTFIADLVVGLRTGQIKTGAP
ARSERLAKLNQLLRIEEELGDNAVFAGENFHHGDKL

3D structure

PDB

1one A carboxylate oxygen of the substrate bridges the magnesium ions at the active site of enolase: structure of the yeast enzyme complexed with the equilibrium mixture of 2-phosphoglycerate and phosphoenolpyruvate at 1.8 A resolution.

Chain

Resolution

1.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	S39 H159 E168 E211 D246 E295 D320 K345 H373 K396
Catalytic site (residue number reindexed from 1)	S39 H159 E168 E211 D246 E295 D320 K345 H373 K396
Enzyme Commision number	4.2.1.11: phosphopyruvate hydratase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	MG	A	D246 E295 D320	D246 E295 D320
BS02	PEP	A	G37 A38 S39 H159 Q167 E168 D246 D320 K345 R374 S375 K396	G37 A38 S39 H159 Q167 E168 D246 D320 K345 R374 S375 K396
BS03	2PG	A	G37 A38 S39 H159 Q167 E168 E211 D246 D320 K345 H373 R374 S375 K396	G37 A38 S39 H159 Q167 E168 E211 D246 D320 K345 H373 R374 S375 K396

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0004634	phosphopyruvate hydratase activity
GO:0016829	lyase activity
GO:0046872	metal ion binding
GO:1904408	melatonin binding

	Biological Process
GO:0006096	glycolytic process
GO:0032889	regulation of vacuole fusion, non-autophagic

	Cellular Component
GO:0000015	phosphopyruvate hydratase complex
GO:0000324	fungal-type vacuole
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005886	plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1one, PDBe:1one, PDBj:1one
PDBsum	1one
PubMed	8605183
UniProt	P00924\|ENO1_YEAST Enolase 1 (Gene Name=ENO1)

[Back to BioLiP]