Structure of PDB 1omd Chain A

Receptor sequence
>1omdA (length=107) Species: 10116 (Rattus norvegicus) [Search protein sequence]
ITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFID
NDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADE
FQEMVHS
3D structure
PDB1omd Structure of oncomodulin refined at 1.85 A resolution. An example of extensive molecular aggregation via Ca2+.
ChainA
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D90 D92 D94 K96 E101 D89 D91 D93 K95 E100
BS02 CA A D51 D53 S55 Y57 E62 D50 D52 S54 Y56 E61
BS03 CA A Q71 D73 Q70 D72
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
Biological Process
GO:0009611 response to wounding
GO:0090102 cochlea development
Cellular Component
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0031982 vesicle
GO:0032420 stereocilium
GO:0032437 cuticular plate
GO:0032991 protein-containing complex
GO:0099512 supramolecular fiber

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1omd, PDBe:1omd, PDBj:1omd
PDBsum1omd
PubMed2231727
UniProtP02631|ONCO_RAT Oncomodulin (Gene Name=Ocm)

[Back to BioLiP]