Structure of PDB 1om2 Chain A

Receptor sequence

>1om2A (length=95) Species: 10116 (Rattus norvegicus)

RAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVC
GQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLGEDDVE

3D structure

• PDB: 1om2 Structural basis of presequence recognition by the mitochondrial protein import receptor Tom20.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	L21 I24 Q25 E28 E29 V59 T63	L21 I24 Q25 E28 E29 V59 T63

Gene Ontology

Biological Process

• GO:0006605 protein targeting
• GO:0006886 intracellular protein transport

Cellular Component

• GO:0005742 mitochondrial outer membrane translocase complex

External links

• PDB: RCSB:1om2, PDBe:1om2, PDBj:1om2
• PDBsum: 1om2
• PubMed: 10721992
• UniProt: Q62760|TOM20_RAT Mitochondrial import receptor subunit TOM20 homolog (Gene Name=Tomm20)