Structure of PDB 1ojj Chain A

Receptor sequence

>1ojjA (length=398) Species: 34413 (Humicola insolens)

EKPGETKEVHPQLTTFRCTKRGGCKPATNFIVLDSLSHPIHRAEGLGPGG
CGDWGNPPPKDVCPDVESCAKNCIMEGIPDYSQYGVTTNGTSLRLQHILP
DGRVPSPRVYLLDKTKRRYEMLHLTGFEFTFDVDATKLPCGMNSALYLSE
MHPTGAKSKYNPGGAYYGTGYCDAQCFVTPFINGLGNIEGKGSCCNSMDI
WEANSRASHVAPHTCNKKGLYLCEGEECAFEGVCDKNGCGWNNYRVNVTD
YYGRGEEFKVNTLKPFTVVTQFLANRRGKLEKIHRFYVQDGKVIESFYTN
KEGVPYTNMIDDEFCEATGSRKYMELGATQGMGEALTRGMVLAMSIWWDQ
GGNMEWLDHGEAGPCAKGEGAPSNIVQVEPFPEVTYTNLRWGEIGSTY

3D structure

• PDB: 1ojj Anatomy of Glycosynthesis: Structure and Kinetics of the Humicola Insolens Cel7B E197A and E197S Glycosynthase Mutants
• Chain: A
• Resolution: 1.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S197 D199 E202 H213
• Catalytic site (residue number reindexed from 1): S197 D199 E202 H213
• Enzyme Commision number: 3.2.1.4: cellulase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	A	H209 N237	H209 N237
BS02	GAL	A	Q175 N237 W356	Q175 N237 W356
BS03	GLC	A	A145 Y147 D173 Q175 D199 E202 W347	A145 Y147 D173 Q175 D199 E202 W347
BS04	GAL	A	R108 Y147 S345 W347	R108 Y147 S345 W347

Gene Ontology

Molecular Function

• GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds
• GO:0008810 cellulase activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0030245 cellulose catabolic process

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1ojj, PDBe:1ojj, PDBj:1ojj
• PDBsum: 1ojj
• PubMed: 12890535
• UniProt: P56680|GUN1_HUMIN Endoglucanase 1 (Gene Name=CEL7B)