Structure of PDB 1oi0 Chain A |
>1oi0A (length=108) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] |
GSSMKISRGLLKTILEAAKSAHPDEFIALLSGSKDVMDELIFLPFVSIGM KVFGTVHSHPSPSCRPSEEDLSLFTRFGKYHIIVCYPYDENSWKCYNRKG EEVELEVV |
|
PDB | 1oi0 The Structure of the Jab1/Mpn Domain and its Implications for Proteasome Function |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H70 H72 D83 |
H57 H59 D70 |
|
|
|
|