Structure of PDB 1oht Chain A

Receptor sequence

>1ohtA (length=173) Species: 7227 (Drosophila melanogaster)

TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTPDCMKSMR
DMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAHAPKYNDKSVGI
VLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLLGHRQVRDTECP
GGRLFAEISSWPHFTHINDTEGV

3D structure

• PDB: 1oht Crystal Structure of Peptidoglycan Recognition Protein Lb from Drosophila Melanogaster
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y78
• Catalytic site (residue number reindexed from 1): Y67
• Enzyme Commision number: 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H42 H152 C160 V184	H31 H141 C149 V173

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0008745 N-acetylmuramoyl-L-alanine amidase activity
• GO:0016787 hydrolase activity
• GO:0042834 peptidoglycan binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002814 negative regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria
• GO:0009253 peptidoglycan catabolic process
• GO:0045087 innate immune response
• GO:0050830 defense response to Gram-positive bacterium
• GO:0061060 negative regulation of peptidoglycan recognition protein signaling pathway

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1oht, PDBe:1oht, PDBj:1oht
• PDBsum: 1oht
• PubMed: 12845326
• UniProt: Q8INK6|PGPLB_DROME Peptidoglycan-recognition protein LB (Gene Name=PGRP-LB)