Structure of PDB 1odg Chain A

Receptor sequence
>1odgA (length=134) Species: 562 (Escherichia coli) [Search protein sequence]
AIEKRLASLLTGQGLAFRVQDASLPGRPDFVVDEYRCVIFTHGCFWHHHH
CYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIVWECALRGR
EKLTDEALTERLEEWICGEGASAQIDTQGIHLLA
3D structure
PDB1odg Crystal Structure of the Escherichia Coli Dcm Very-Short-Patch DNA Repair Endonuclease Bound to its Reaction Product-Site in a DNA Superhelix
ChainA
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D51 T63 H69 D97
Catalytic site (residue number reindexed from 1) D29 T41 H47 D75
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A W68 P79 R82 W86 K89 K124 W46 P57 R60 W64 K67 K102
BS02 dna A H64 W68 H69 N93 H42 W46 H47 N71
BS03 ZN A C66 H71 C73 C117 C44 H49 C51 C95
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006298 mismatch repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1odg, PDBe:1odg, PDBj:1odg
PDBsum1odg
PubMed12626704
UniProtP09184|VSR_ECOLI DNA mismatch endonuclease Vsr (Gene Name=vsr)

[Back to BioLiP]