Structure of PDB 1ob5 Chain A

Receptor sequence

>1ob5A (length=400) Species: 271 (Thermus aquaticus) [Search protein sequence]

IRTKPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEVKDYGDIDKAPE
ERARGITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILV
VSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLVEMEVR
DLLNQYEFPGDEVPVIRGSALLALEEMHKNPKTKRGENEWVDKIWELLDA
IDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVGDEVEI
VGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLA
KPGSITPHTKFEASVYILKKEEGGRHTGFFTGYRPQFYFRTTDVTGVVRL
PQGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGGRTVGAGVVTKILE

3D structure

PDB

1ob5 Enacyloxin Iia Pinpoints a Binding Pocket of Elongation Factor TU for Development of Novel Antibiotics.

Chain

Resolution

3.1 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D21 K24 T25 T62 H85
Catalytic site (residue number reindexed from 1)	D16 K19 T20 T57 H80
Enzyme Commision number	3.6.1.48: Transferred entry: 3.6.5.3.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	A	K52 P54 I63 N64 H67 Y88 K90 N91 F229 T230 I231 R234 V237 T239 G269 E271 M272 H273 R274 N285 V286 G287 L289 R295 R300 R330 H331 T332 G337 Y338 R339 Q341 T350 E390 G391 G392	K47 P49 I58 N59 H62 Y83 K85 N86 F224 T225 I226 R229 V232 T234 G264 E266 M267 H268 R269 N280 V281 G282 L284 R290 R295 R325 H326 T327 G332 Y333 R334 Q336 T345 E385 G386 G387
BS02	rna	A	F335 T336 R354 E360	F330 T331 R349 E355
BS03	GNP	A	V20 D21 G23 K24 T25 T26 Y47 I61 T62 G84 N136 K137 D139 M140 S174 L176	V15 D16 G18 K19 T20 T21 Y42 I56 T57 G79 N131 K132 D134 M135 S169 L171
BS04	MG	A	K24 T25 T62 D81 C82	K19 T20 T57 D76 C77
BS05	ENX	A	Q125 V126 Y161 L323 K325 E326 E327 G328 Y343 R345 F386 A387	Q120 V121 Y156 L318 K320 E321 E322 G323 Y338 R340 F381 A382

Gene Ontology

	Molecular Function
GO:0003746	translation elongation factor activity
GO:0003924	GTPase activity
GO:0005525	GTP binding

	Biological Process
GO:0006412	translation
GO:0006414	translational elongation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ob5, PDBe:1ob5, PDBj:1ob5
PDBsum	1ob5
PubMed	16257965
UniProt	Q01698\|EFTU_THEAQ Elongation factor Tu (Gene Name=tuf)

[Back to BioLiP]