Structure of PDB 1oae Chain A

Receptor sequence

>1oaeA (length=124) Species: 17 (Methylophilus methylotrophus)

DVTNAEKLVYKYTNIAHSANPMYEAPSITDGKIFFNRKFKTPSGKEAACA
SCHTNNPANVGKNIVTGKEIPPLAPRVNTKRFTDIDKVEDEFTKHCNDIL
GADCSPSEKANFIAYLLTETKPTK

3D structure

• PDB: 1oae Structural Evidence for a Proton Transfer Pathway Coupled with Haem Reduction of Cytochrome C" from Methylophilus Methylotrophus.
• Chain: A
• Resolution: 1.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C49 C52 H53 I70 L73 R81 E91 F92 H95 I99	C49 C52 H53 I70 L73 R81 E91 F92 H95 I99

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0008150 biological_process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:1oae, PDBe:1oae, PDBj:1oae
• PDBsum: 1oae
• PubMed: 16341897
• UniProt: Q9RQB9|CYCA_METME Cytochrome c'' (Gene Name=cycA)