Structure of PDB 1o4h Chain A |
>1o4hA (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] |
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDF DNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL TTVCPT |
|
PDB | 1o4h Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors. |
Chain | A |
Resolution | 2.25 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.10.2: non-specific protein-tyrosine kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
772 |
A |
R14 R34 E37 C44 |
R14 R34 E37 C44 |
MOAD: ic50=3.6mM PDBbind-CN: -logKd/Ki=2.44,IC50=3.6mM |
|
|