Structure of PDB 1nxt Chain A |
>1nxtA (length=116) Species: 170187 (Streptococcus pneumoniae TIGR4) [Search protein sequence] |
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIIL DLMLPDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPF SNRELQARVKALLRRS |
|
PDB | 1nxt Crystal structure of the response regulator 02 receiver domain, the essential YycF two-component system of Streptococcus pneumoniae in both complexed and native states. |
Chain | A |
Resolution | 2.34 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
XE |
A |
L61 E62 K65 |
L58 E59 K62 |
|
|
|
|