Structure of PDB 1nxk Chain A

Receptor sequence
>1nxkA (length=290) Species: 9606 (Homo sapiens) [Search protein sequence]
QFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFA
LKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECL
DGGELFSRIQDRAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLY
TSKRPNAILKLTDFGFAKETTPYYVAPEVLGPEKYDKSCDMWSLGVIMYI
LLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNL
LKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKED
3D structure
PDB1nxk Catalytically active MAP KAP kinase 2 structures in complex with staurosporine and ADP reveal differences with the autoinhibited enzyme
ChainA
Resolution2.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D186 K188 E190 N191 D207
Catalytic site (residue number reindexed from 1) D142 K144 E146 N147 D163
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 STU A L70 G71 G73 V78 A91 M138 C140 L141 E190 L193 T206 D207 L29 G30 G32 V37 A50 M97 C99 L100 E146 L149 T162 D163
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004683 calcium/calmodulin-dependent protein kinase activity
GO:0005515 protein binding
GO:0005516 calmodulin binding
GO:0005524 ATP binding
GO:0009931 calcium-dependent protein serine/threonine kinase activity
GO:0044024 histone H2AS1 kinase activity
GO:0051019 mitogen-activated protein kinase binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0002224 toll-like receptor signaling pathway
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0006691 leukotriene metabolic process
GO:0006954 inflammatory response
GO:0006974 DNA damage response
GO:0010803 regulation of tumor necrosis factor-mediated signaling pathway
GO:0016310 phosphorylation
GO:0018105 peptidyl-serine phosphorylation
GO:0032496 response to lipopolysaccharide
GO:0032675 regulation of interleukin-6 production
GO:0032680 regulation of tumor necrosis factor production
GO:0032760 positive regulation of tumor necrosis factor production
GO:0034097 response to cytokine
GO:0035556 intracellular signal transduction
GO:0035924 cellular response to vascular endothelial growth factor stimulus
GO:0038066 p38MAPK cascade
GO:0043488 regulation of mRNA stability
GO:0044351 macropinocytosis
GO:0048010 vascular endothelial growth factor receptor signaling pathway
GO:0048255 mRNA stabilization
GO:0048839 inner ear development
GO:0060907 positive regulation of macrophage cytokine production
GO:0070935 3'-UTR-mediated mRNA stabilization
GO:1900034 regulation of cellular response to heat
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1nxk, PDBe:1nxk, PDBj:1nxk
PDBsum1nxk
PubMed12791252
UniProtP49137|MAPK2_HUMAN MAP kinase-activated protein kinase 2 (Gene Name=MAPKAPK2)

[Back to BioLiP]