Structure of PDB 1nx1 Chain A

Receptor sequence
>1nx1A (length=173) Species: 9823 (Sus scrofa) [Search protein sequence]
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCR
SMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELP
GAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKS
LDKDGTGQIQVNIQEWLQLTMYS
3D structure
PDB1nx1 A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) F162 G185 I187
Catalytic site (residue number reindexed from 1) F69 G92 I94
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A L102 L106 R128 H129 W166 Q173 A174 K177 L9 L13 R35 H36 W73 Q80 A81 K84
BS02 CA A G108 D110 E112 E117 K156 G15 D17 E19 E24 K63
BS03 CA A D150 D152 T154 K156 E161 D57 D59 T61 K63 E68
BS04 CA A D180 D182 S184 T186 D87 D89 S91 T93
BS05 CA A D135 D223 D225 N226 D42 D130 D132 N133
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1nx1, PDBe:1nx1, PDBj:1nx1
PDBsum1nx1
PubMed12684003
UniProtP04574|CPNS1_PIG Calpain small subunit 1 (Gene Name=CAPNS1)

[Back to BioLiP]