Structure of PDB 1nx0 Chain A

Receptor sequence

>1nx0A (length=173) Species: 9823 (Sus scrofa) [Search protein sequence]

EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCR
SMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELP
GAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKS
LDKDGTGQIQVNIQEWLQLTMYS

3D structure

PDB

1nx0 A structural model for the inhibition of calpain by calpastatin: crystal structures of the native domain VI of calpain and its complexes with calpastatin peptide and a small molecule inhibitor.

Chain

Resolution

2.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	F162 G185 I187
Catalytic site (residue number reindexed from 1)	F69 G92 I94
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	L102 L106 V125 R128 H129 L132 W166 K170 Q173 A174 F224	L9 L13 V32 R35 H36 L39 W73 K77 Q80 A81 F131
BS02	peptide	A	G200 F201 H202 D235 F238	G107 F108 H109 D142 F145
BS03	CA	A	A107 D110 E112 E117	A14 D17 E19 E24
BS04	CA	A	D150 D152 T154 K156 E161	D57 D59 T61 K63 E68
BS05	CA	A	D180 D182 S184 T186	D87 D89 S91 T93

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding

View graph for
Molecular Function

External links

PDB	RCSB:1nx0, PDBe:1nx0, PDBj:1nx0
PDBsum	1nx0
PubMed	12684003
UniProt	P04574\|CPNS1_PIG Calpain small subunit 1 (Gene Name=CAPNS1)

[Back to BioLiP]