Structure of PDB 1nwo Chain A |
>1nwoA (length=128) Species: 303 (Pseudomonas putida) [Search protein sequence] |
AECKVTVDSTDQMSFNTKDIAIDKSCKTFTVELTHSGSLPKNVMGHNLVI SKEADMQPIATDGLSAGIDKQYLKDGDARVIAHTKVIGAGEKDSVTFDVS KLAAGEKYGFFCSFPGHISMMKGTVTLK |
|
PDB | 1nwo Crystallographic study of azurin from Pseudomonas putida. |
Chain | A |
Resolution | 1.92 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H46 C112 H117 |
H46 C112 H117 |
|
|
|
|