Structure of PDB 1nv6 Chain A

Receptor sequence
>1nv6A (length=329) Species: 9823 (Sus scrofa) [Search protein sequence]
DTNIVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAISTAVRKAGIAHL
YGIAGSTNVTGDQVKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVE
PEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPG
RNLVAAGYALYGSATMLVLAMVNGVNCFMLDPAIGEFILVDRDVKIKKKG
SIYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIV
PTDIHQRAPIILGSPEDVTELLEIYQKHA
3D structure
PDB1nv6 Interaction of Tl+ with product complexes of fructose-1,6-bisphosphatase
ChainA
Resolution2.15 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D1068 D1074 E1097 E1098 D1118 L1120 D1121 E1280
Catalytic site (residue number reindexed from 1) D62 D68 E91 E92 D112 L114 D115 E274
Enzyme Commision number 3.1.3.11: fructose-bisphosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 F6P A D1121 N1212 Y1215 Y1244 S1247 M1248 Y1264 K1274 D115 N206 Y209 Y238 S241 M242 Y258 K268
BS02 MG A E1097 D1118 D1121 E1280 E91 D112 D115 E274
BS03 MG A E1097 D1118 L1120 E91 D112 L114
BS04 PO4 A G1026 T1027 G1028 M1030 K1112 Y1113 G20 T21 G22 M24 K106 Y107
Gene Ontology
Molecular Function
GO:0016208 AMP binding
GO:0016787 hydrolase activity
GO:0016791 phosphatase activity
GO:0042132 fructose 1,6-bisphosphate 1-phosphatase activity
GO:0042578 phosphoric ester hydrolase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0048029 monosaccharide binding
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0005986 sucrose biosynthetic process
GO:0006000 fructose metabolic process
GO:0006002 fructose 6-phosphate metabolic process
GO:0006094 gluconeogenesis
GO:0006111 regulation of gluconeogenesis
GO:0016311 dephosphorylation
GO:0030308 negative regulation of cell growth
GO:0030388 fructose 1,6-bisphosphate metabolic process
GO:0045820 negative regulation of glycolytic process
GO:0046580 negative regulation of Ras protein signal transduction
GO:0071286 cellular response to magnesium ion
GO:0071466 cellular response to xenobiotic stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1nv6, PDBe:1nv6, PDBj:1nv6
PDBsum1nv6
PubMed12595529
UniProtP00636|F16P1_PIG Fructose-1,6-bisphosphatase 1 (Gene Name=FBP1)

[Back to BioLiP]