Structure of PDB 1nv5 Chain A

Receptor sequence

>1nv5A (length=331) Species: 9823 (Sus scrofa) [Search protein sequence]

DTNIVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAISTAVRKAGIAHL
YGIAGSTNVTGDQVKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVE
PEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPG
RNLVAAGYALYGSATMLVLAMVNGVNCFMLDPAIGEFILVDRDVKIKKKG
SIYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIV
PTDIHQRAPIILGSPEDVTELLEIYQKHAAK

3D structure

PDB

1nv5 Interaction of Tl+ with product complexes of fructose-1,6-bisphosphatase

Chain

Resolution

1.9 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D1068 D1074 E1097 E1098 D1118 L1120 D1121 E1280
Catalytic site (residue number reindexed from 1)	D62 D68 E91 E92 D112 L114 D115 E274
Enzyme Commision number	3.1.3.11: fructose-bisphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	F6P	A	D1121 N1212 Y1215 Y1244 G1246 M1248 Y1264 K1274 L1275 E1280	D115 N206 Y209 Y238 G240 M242 Y258 K268 L269 E274
BS02	MG	A	D1118 D1121 E1280	D112 D115 E274
BS03	MG	A	E1097 D1118 L1120	E91 D112 L114
BS04	PO4	A	G1026 T1027 G1028 E1029 M1030 K1112 Y1113	G20 T21 G22 E23 M24 K106 Y107
BS05	PO4	A	E1097 D1118 L1120 G1122 S1123	E91 D112 L114 G116 S117

Gene Ontology

	Molecular Function
GO:0016208	AMP binding
GO:0016787	hydrolase activity
GO:0016791	phosphatase activity
GO:0042132	fructose 1,6-bisphosphate 1-phosphatase activity
GO:0042578	phosphoric ester hydrolase activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0048029	monosaccharide binding

	Biological Process
GO:0005975	carbohydrate metabolic process
GO:0005986	sucrose biosynthetic process
GO:0006000	fructose metabolic process
GO:0006002	fructose 6-phosphate metabolic process
GO:0006094	gluconeogenesis
GO:0006111	regulation of gluconeogenesis
GO:0016311	dephosphorylation
GO:0030308	negative regulation of cell growth
GO:0030388	fructose 1,6-bisphosphate metabolic process
GO:0045820	negative regulation of glycolytic process
GO:0046580	negative regulation of Ras protein signal transduction
GO:0071286	cellular response to magnesium ion
GO:0071466	cellular response to xenobiotic stimulus

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1nv5, PDBe:1nv5, PDBj:1nv5
PDBsum	1nv5
PubMed	12595529
UniProt	P00636\|F16P1_PIG Fructose-1,6-bisphosphatase 1 (Gene Name=FBP1)

[Back to BioLiP]