Structure of PDB 1nuw Chain A

Receptor sequence

>1nuwA (length=328) Species: 9823 (Sus scrofa) [Search protein sequence]

TNIVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAISTAVRKAGIAHLY
GIAGSTNVTGDQVKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVEP
EKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPGR
NLVAAGYALYGSATMLVLAMVNGVNCFMLDPAIGEFILVDRDVKIKKKGS
IYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLV
YGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIVP
TDIHQRAPIILGSPEDVTELLEIYQKHA

3D structure

PDB

1nuw Metaphosphate in the active site of fructose-1,6-bisphosphatase

Chain

Resolution

1.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D1068 D1074 E1097 E1098 D1118 L1120 D1121 E1280
Catalytic site (residue number reindexed from 1)	D61 D67 E90 E91 D111 L113 D114 E273
Enzyme Commision number	3.1.3.11: fructose-bisphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	F6P	A	D1121 G1122 N1212 Y1215 Y1244 G1246 S1247 M1248 Y1264 K1274 R1276	D114 G115 N205 Y208 Y237 G239 S240 M241 Y257 K267 R269
BS02	PO3	A	E1097 D1118 D1121 G1122 S1123 R1276	E90 D111 D114 G115 S116 R269
BS03	MG	A	E1097 D1118 L1120	E90 D111 L113
BS04	MG	A	E1097 D1118 D1121 R1276 E1280	E90 D111 D114 R269 E273
BS05	MG	A	N1064 E1097 E1098	N57 E90 E91
BS06	MG	A	D1068 E1097	D61 E90

Gene Ontology

	Molecular Function
GO:0016208	AMP binding
GO:0016787	hydrolase activity
GO:0016791	phosphatase activity
GO:0042132	fructose 1,6-bisphosphate 1-phosphatase activity
GO:0042578	phosphoric ester hydrolase activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0048029	monosaccharide binding

	Biological Process
GO:0005975	carbohydrate metabolic process
GO:0005986	sucrose biosynthetic process
GO:0006000	fructose metabolic process
GO:0006002	fructose 6-phosphate metabolic process
GO:0006094	gluconeogenesis
GO:0006111	regulation of gluconeogenesis
GO:0016311	dephosphorylation
GO:0030308	negative regulation of cell growth
GO:0030388	fructose 1,6-bisphosphate metabolic process
GO:0045820	negative regulation of glycolytic process
GO:0046580	negative regulation of Ras protein signal transduction
GO:0071286	cellular response to magnesium ion
GO:0071466	cellular response to xenobiotic stimulus

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1nuw, PDBe:1nuw, PDBj:1nuw
PDBsum	1nuw
PubMed	12595528
UniProt	P00636\|F16P1_PIG Fructose-1,6-bisphosphatase 1 (Gene Name=FBP1)

[Back to BioLiP]