Structure of PDB 1nu5 Chain A

Receptor sequence

>1nu5A (length=369) Species: 65067 (Pseudomonas sp. P51)

MKIEAISTTIVDVPTRRPLQMSFTTVHKQSYVIVQVKAGGLVGIGEGGSV
GGPTWGSESAETIKVIIDNYLAPLLVGKDASNLSQARVLMDRAVTGNLSA
KAAIDIALHDLKARALNLSIADLIGGTMRTSIPIAWTLASGDTARDIDSA
LEMIETRRHNRFKVKLGARTPAQDLEHIRSIVKAVGDRASVRVDVNQGWD
EQTASIWIPRLEEAGVELVEQPVPRANFGALRRLTEQNGVAILADESLSS
LSSAFELARDHAVDAFSLKLCNMGGIANTLKVAAVAEAAGISSYGGTMLD
STVGTAAALHVYATLPSLPYGCELIGPWVLGDRLTQQDLEIKDFEVHLPL
GSGLGVDLDHDKVRHYTRA

3D structure

• PDB: 1nu5 The structure of Pseudomonas P51 Cl-muconate lactonizing enzyme: co-evolution of structure and dynamics with the dehalogenation function.
• Chain: A
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): L19 S49 G52 T137 K163 K165 E176 D194 N196 E220 D245 E246 S247 K269 G296 T297 M298 C322 E323 L324
• Catalytic site (residue number reindexed from 1): L19 S49 G52 T137 K163 K165 E176 D194 N196 E220 D245 E246 S247 K269 G296 T297 M298 C322 E323 L324
• Enzyme Commision number: 5.5.1.7: chloromuconate cycloisomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	D194 E220 D245	D194 E220 D245
BS02	MN	A	T235 N238	T235 N238

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0016853 isomerase activity
• GO:0018849 muconate cycloisomerase activity
• GO:0018850 chloromuconate cycloisomerase activity
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009056 catabolic process
• GO:0009063 amino acid catabolic process
• GO:0046300 2,4-dichlorophenoxyacetic acid catabolic process

External links

• PDB: RCSB:1nu5, PDBe:1nu5, PDBj:1nu5
• PDBsum: 1nu5
• PubMed: 12930985
• UniProt: P27099|TCBD_PSESQ Chloromuconate cycloisomerase (Gene Name=tcbD)