Structure of PDB 1npl Chain A

Receptor sequence
>1nplA (length=109) Species: 39639 (Narcissus pseudonarcissus) [Search protein sequence]
DNILYSGETLSPGEFLNNGRYVFIMQEDCNLVLYDVDKPIWATNTGGLDR
RCHLSMQSDGNLVVYSPRNNPIWASNTGGENGNYVCVLQKDRNVVIYGTA
RWATGTNIH
3D structure
PDB1npl Insights into carbohydrate recognition by Narcissus pseudonarcissus lectin: the crystal structure at 2 A resolution in complex with alpha1-3 mannobiose.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MAN A Q89 D91 N93 Q89 D91 N93
BS02 MAN A Q26 D28 N30 Y34 Q26 D28 N30 Y34
BS03 MAN A Q57 D59 N61 Q57 D59 N61
BS04 MAN A W41 A42 W73 W41 A42 W73
Gene Ontology
Molecular Function
GO:0005537 D-mannose binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006952 defense response
GO:0009615 response to virus
GO:0050688 regulation of defense response to virus
GO:0051607 defense response to virus
GO:0051707 response to other organism
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1npl, PDBe:1npl, PDBj:1npl
PDBsum1npl
PubMed10388566
UniProtC0HM45|LEC_NARPS Mannose-specific lectin

[Back to BioLiP]