Structure of PDB 1npi Chain A

Receptor sequence
>1npiA (length=61) Species: 6887 (Tityus serrulatus) [Search protein sequence]
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNW
VKVWDRATNKC
3D structure
PDB1npi Structural analysis of Tityus serrulatus Ts1 neurotoxin at atomic resolution: insights into interactions with Na+ channels.
ChainA
Resolution1.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PO4 A K1 N49 K1 N49
BS02 PO4 A K12 W54 R56 K12 W54 R56
Gene Ontology
Molecular Function
GO:0008200 ion channel inhibitor activity
GO:0017080 sodium channel regulator activity
GO:0019871 sodium channel inhibitor activity
GO:0090729 toxin activity
Biological Process
GO:0006952 defense response
GO:0031640 killing of cells of another organism
GO:0035821 modulation of process of another organism
GO:0050832 defense response to fungus
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1npi, PDBe:1npi, PDBj:1npi
PDBsum1npi
PubMed12595696
UniProtP15226|SCX1_TITSE Beta-mammal/insect toxin Ts1

[Back to BioLiP]