Structure of PDB 1nme Chain A |
>1nmeA (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] |
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETF RNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIF GTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET |
|
PDB | 1nme In situ assembly of enzyme inhibitors using extended tethering. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
158 |
A |
R64 S120 H121 C163 |
R36 S92 H93 C135 |
|
|
|
|