Structure of PDB 1new Chain A

Receptor sequence

>1newA (length=68) Species: 891 (Desulfuromonas acetoxidans)

ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACK
TCHKSNNGPTKCGGCHIK

3D structure

• PDB: 1new 800 MHz 1H NMR solution structure refinement of oxidized cytochrome c7 from Desulfuromonas acetoxidans.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	Y6 H17 H20 A21 L24 C26 C29 H30 P34 I39	Y6 H17 H20 A21 L24 C26 C29 H30 P34 I39
BS02	HEC	A	T14 F15 H20 K23 L24 A28 C29 A48 C49 C52 H53 N56 N57 P59	T14 F15 H20 K23 L24 A28 C29 A48 C49 C52 H53 N56 N57 P59
BS03	HEC	A	N8 K9 K10 F15 K41 A44 H45 C49 H53 C62 C65 H66	N8 K9 K10 F15 K41 A44 H45 C49 H53 C62 C65 H66

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

External links

• PDB: RCSB:1new, PDBe:1new, PDBj:1new
• PDBsum: 1new
• PubMed: 9760163
• UniProt: P00137|CYC3_DESAC Cytochrome c3 (Gene Name=cyd)