Structure of PDB 1nbb Chain A

Receptor sequence

>1nbbA (length=129) Species: 1061 (Rhodobacter capsulatus)

ADTKEVLEAREAYFKSLGGSMKAMTGVAKAFDAEAAKVEAAKLEKILATD
VAPLFPAGTSSTDLPGQTEAKAAIWANMDDFGAKGKAMHEAGGAVIAAAN
AGDGAAFGAALQKLGGTCKACHDDYREED

3D structure

• PDB: 1nbb Concerted movement of side chains in the haem vicinity observed on ligand binding in cytochrome c' from rhodobacter capsulatus.
• Chain: A
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	F14 M21 T68 E69 F81 K84 G85 C118 C121 H122 R126	F14 M21 T68 E69 F81 K84 G85 C118 C121 H122 R126

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1nbb, PDBe:1nbb, PDBj:1nbb
• PDBsum: 1nbb
• PubMed: 8612077
• UniProt: P00147|CYCP_RHOCA Cytochrome c'